Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RLN2 Rabbit pAb (APR26982N)

Product Specifications

Background

This gene encodes a member of the relaxin subfamily and insulin superfamily of peptide hormones. In humans there are three non-allelic relaxin genes. This gene encodes multiple protein isoforms, at least one of which undergoes proteolytic processing. This processing generates relaxin A and B chains that are linked by disulfide bonds to form the mature peptide hormone. This hormone plays a role in the male and female reproductive systems and was initially noted for its role in pregnancy. This protein also plays broader roles in the cardiovascular system, including in the regulation of blood pressure and control of heart rate, and data from animal models shows that this protein may have anti-fibrotic and cardioprotective effects.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RLN2 Rabbit pAb (APR26982N) .

Synonyms

RLN2; H2; H2-RLX; RLXH2; bA12D24.1.1; bA12D24.1.2; relaxin 2

Gene ID

6019

UniProt

P04090

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa/21kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6019

Uniprot URL

https://www.uniprot.org/uniprot/P04090

AA Sequence

DSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

4.1R Polyclonal Antibody
JOT-AP00033-01 50ul

4.1R Polyclonal Antibody

Ask
View Details
4.1R Polyclonal Antibody
JOT-AP00033-02 100ul

4.1R Polyclonal Antibody

Ask
View Details
MUC1, Phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial
MBS6322909-01 0.1 mL

MUC1, Phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial

Ask
View Details
MUC1, Phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial
MBS6322909-02 5x 0.1 mL

MUC1, Phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial

Ask
View Details
Cy3-Linked Polyclonal Antibody to Translocation Associated Notch Homolog 1 (TAN1)
MBS2110510-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Translocation Associated Notch Homolog 1 (TAN1)

Ask
View Details
Cy3-Linked Polyclonal Antibody to Translocation Associated Notch Homolog 1 (TAN1)
MBS2110510-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Translocation Associated Notch Homolog 1 (TAN1)

Ask
View Details