Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD13 Rabbit pAb (APR26970N)

Product Specifications

Background

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Two transcripts encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PSMD13 Rabbit pAb (APR26970N) .

Synonyms

PSMD13; HSPC027; Rpn9; S11; p40.5

Gene ID

5719

UniProt

Q9UNM6

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5719

Uniprot URL

https://www.uniprot.org/uniprot/Q9UNM6

AA Sequence

MKDVPGFLQQSQNSGPGQPAVWHRLEELYTKKLWHQLTLQVLDFVQDPCFAQGDGLIKLYENFISEFEHRVNPLSLVEIILHVVRQMTDPNVALTFLEKTREKVKSSDEAVILCKTAIGALKLNIGDLQVTKETIEDVEEMLNNLPGVTSVHSRFYDLSSKYYQTIGNHASYYKDALRFLGCVDIKDLPVSEQQERAFTLGLAGLLGEGVFNFGELLMHPVLESLRNTDRQWLIDTLYAFNSGNVERFQT

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 650)
MBS6226000-01 0.1 mL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 650)

Ask
View Details
Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 650)
MBS6226000-02 5x 0.1 mL

Cytokeratin 8 (CARD2, CK8, CYK8, CYKER, Cytokeratin Endo A, DreK8, EndoA, K2C8, K8, Keratin 8, Krt 2.8, KRT8, Type-II Keratin Kb8) (BSA & Azide Free) (MaxLight 650)

Ask
View Details
Quinolin-4(1H)-one
TRC-Q990023-500MG 500 mg

Quinolin-4(1H)-one

Ask
View Details
Albumin (BCP) Microplate Assay Kit
E51K1151 100 Assays

Albumin (BCP) Microplate Assay Kit

Ask
View Details
Rat VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit
ER1420 96 Tests

Rat VASPIN (Visceral Adipose Specific Serine Protease Inhibitor) ELISA Kit

Ask
View Details
SRC (Proto-oncogene Tyrosine-protein Kinase Src, Proto-oncogene c-Src, pp60c-src, p60-Src, SRC1) (MaxLight 405) discontinued
133823-ML405 100 µL

SRC (Proto-oncogene Tyrosine-protein Kinase Src, Proto-oncogene c-Src, pp60c-src, p60-Src, SRC1) (MaxLight 405) discontinued

Ask
View Details