Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRGN Rabbit pAb (APR26965N)

Product Specifications

Background

This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. This encoded protein was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis. Two transcript variants, only one of them protein-coding, have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SRGN Rabbit pAb (APR26965N) .

Synonyms

SRGN; PPG; PRG; PRG1; serglycin

Gene ID

5552

UniProt

P10124

Cellular Locus

Cytoplasmic granule, Golgi apparatus, Secreted, extracellular space

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 17kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5552

Uniprot URL

https://www.uniprot.org/uniprot/P10124

AA Sequence

YPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS510337 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Bacteriochlorophyll a
bs-7002C-01 2 mg

Bacteriochlorophyll a

Sign In for Pricing
View Details
Bacteriochlorophyll a
bs-7002C-02 10 mg

Bacteriochlorophyll a

Sign In for Pricing
View Details
NMD3 Protein Vector (Mouse) (pPB-C-His)
PV205854 500 ng

NMD3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
GCAP1, Human (sf9, His-GST)
HY-P76945 1 Each

GCAP1, Human (sf9, His-GST)

Sign In for Pricing
View Details
Human Keratin 10 (KRT10) ELISA Kit
RD-KRT10-Hu-01 96 Tests

Human Keratin 10 (KRT10) ELISA Kit

Sign In for Pricing
View Details