Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H1.0 Rabbit pAb (APR26933N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-independent histone that is a member of the histone H1 family.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Histone H1.0 Rabbit pAb (APR26933N) .

Synonyms

H1F0; H10; H1FV; histone H1.0

Gene ID

3005

UniProt

P07305

Cellular Locus

Chromosome, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/20kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3005

Uniprot URL

https://www.uniprot.org/uniprot/P07305

AA Sequence

MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TAF7, CT (TAF7, TAF2F, TAFII55, Transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, Transcription initiation factor TFIID 55kD subunit) (MaxLight 650)
MBS6353432-01 0.1 mL

TAF7, CT (TAF7, TAF2F, TAFII55, Transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, Transcription initiation factor TFIID 55kD subunit) (MaxLight 650)

Ask
View Details
TAF7, CT (TAF7, TAF2F, TAFII55, Transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, Transcription initiation factor TFIID 55kD subunit) (MaxLight 650)
MBS6353432-02 5x 0.1 mL

TAF7, CT (TAF7, TAF2F, TAFII55, Transcription initiation factor TFIID subunit 7, RNA polymerase II TBP-associated factor subunit F, Transcription initiation factor TFIID 55kD subunit) (MaxLight 650)

Ask
View Details
Respiratory Syncytial Virus (2F7)
sc-101362 50 µg - 500 µL

Respiratory Syncytial Virus (2F7)

Ask
View Details
Hemoglobin subunit alpha Rabbit mAb
MBS9469796-01 0.05 mL

Hemoglobin subunit alpha Rabbit mAb

Ask
View Details
Hemoglobin subunit alpha Rabbit mAb
MBS9469796-02 0.1 mL

Hemoglobin subunit alpha Rabbit mAb

Ask
View Details
Hemoglobin subunit alpha Rabbit mAb
MBS9469796-03 5x 0.1 mL

Hemoglobin subunit alpha Rabbit mAb

Ask
View Details