Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMO1 Rabbit pAb (APR26923N)

Product Specifications

Background

Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality FMO1 Rabbit pAb (APR26923N) .

Synonyms

FMO1

Gene ID

2326

UniProt

Q01740

Cellular Locus

Endoplasmic reticulum membrane, Microsome membrane

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2326

Uniprot URL

https://www.uniprot.org/uniprot/Q01740

AA Sequence

KPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGKWEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken anti-platelet antibody (APA) ELISA Kit
EIA06677Ch 1 Kit

Chicken anti-platelet antibody (APA) ELISA Kit

Sign In for Pricing
View Details
TPST2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV661151 1.0 µg DNA

TPST2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
RT1-Db1 3'UTR Lenti-reporter-Luc Vector
42828086 1.0 µg

RT1-Db1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
ABCA5 Rabbit Polyclonal Antibody
E28PN0474 100 µL

ABCA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thioredoxin Reductase 1 (TrxR1) (FITC) discontinued
T5010-14A-FITC 100 µL

Thioredoxin Reductase 1 (TrxR1) (FITC) discontinued

Sign In for Pricing
View Details
DYRK4 (NM_001282286) Human Untagged Clone
SC334668 10 µg

DYRK4 (NM_001282286) Human Untagged Clone

Sign In for Pricing
View Details