Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Septin 7 Rabbit pAb (APR26902N)

Product Specifications

Background

This gene encodes a protein that is highly similar to the CDC10 protein of Saccharomyces cerevisiae. The protein also shares similarity with Diff 6 of Drosophila and with H5 of mouse. Each of these similar proteins, including the yeast CDC10, contains a GTP-binding motif. The yeast CDC10 protein is a structural component of the 10 nm filament which lies inside the cytoplasmic membrane and is essential for cytokinesis. This human protein functions in gliomagenesis and in the suppression of glioma cell growth, and it is required for the association of centromere-associated protein E with the kinetochore. Alternative splicing results in multiple transcript variants. Several related pseudogenes have been identified on chromosomes 5, 7, 9, 10, 11, 14, 17 and 19.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Septin 7 Rabbit pAb (APR26902N) .

Synonyms

SEPT7; CDC10; CDC3; NBLA02942; SEPT7A; septin-7

Gene ID

989

UniProt

Q16181

Cellular Locus

Chromosome, Cleavage furrow, Cytoplasm, Midbody, centromere, cilium axoneme, cytoskeleton, kinetochore, spindle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa Observed MW: 51kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=989

Uniprot URL

https://www.uniprot.org/uniprot/Q16181

AA Sequence

NYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQNSSRTLEKNKKKGKIF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PRP19 (PRPF19) Rabbit Polyclonal Antibody
TA329843 100 µL

PRP19 (PRPF19) Rabbit Polyclonal Antibody

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)
MBS2041948-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)
MBS2041948-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)
MBS2041948-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)
MBS2041948-04 1 mL

APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)

Ask
View Details
APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)
MBS2041948-05 5 mL

APC/CY7-Linked Polyclonal Antibody to High Mobility Group Protein 1 (HMG1)

Ask
View Details