Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM20 Rabbit pAb (APR26837N)

Product Specifications

Background

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore (By similarity. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TOM20 Rabbit pAb (APR26837N) .

Synonyms

TOMM20; MAS20; MOM19; TOM20

Gene ID

9804

UniProt

Q15388

Cellular Locus

Mitochondrion outer membrane, Single-pass membrane protein

Applications

IF (Mouse brown fat cells, Rattus norvegicus, Mus musculus) IHC (Mus musculus) WB (Homo sapiens, Mus musculus, Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:20 - 1:50 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: 16KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9804

Uniprot URL

https://www.uniprot.org/uniprot/Q15388

AA Sequence

YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ATM (S1981)
E8ET1705-50 100 µL

Phospho-ATM (S1981)

Sign In for Pricing
View Details
Mouse RWDD4 shRNA Plasmid
abx980411-01 150 µg

Mouse RWDD4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse RWDD4 shRNA Plasmid
abx980411-02 300 µg

Mouse RWDD4 shRNA Plasmid

Sign In for Pricing
View Details
G-CSF (Animal Free)
100-029-L250-AF 250 µg

G-CSF (Animal Free)

Sign In for Pricing
View Details
ZNT8 Polyclonal Antibody, Cy7 Conjugated
bs-22560R-Cy7 100 µL

ZNT8 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31,Aib32)-Pancreatic Polypeptide (human)
H-5088.1000 1.0mg

(Gly1,Ser3·22,Gln4·34,Thr6,Arg19,Tyr21,Ala23·31,Aib32)-Pancreatic Polypeptide (human)

Sign In for Pricing
View Details