Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIN2/TINF2 Rabbit pAb (APR26832N)

Product Specifications

Background

This gene encodes one of the proteins of the shelterin, or telosome, complex which protects telomeres by allowing the cell to distinguish between telomeres and regions of DNA damage. The protein encoded by this gene is a critical part of shelterin; it interacts with the three DNA-binding proteins of the shelterin complex, and it is important for assembly of the complex. Mutations in this gene cause dyskeratosis congenita (DKC), an inherited bone marrow failure syndrome.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TIN2/TINF2 Rabbit pAb (APR26832N) .

Synonyms

TINF2; DKCA3; TIN2

Gene ID

26277

UniProt

Q9BSI4

Cellular Locus

Chromosome, Nucleus, Nucleus matrix, telomere

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa/39kDa/50kDa Observed MW: 40-45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=26277

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSI4

AA Sequence

ECSVTDSVNLAEPMEQNPPQQQRLALHNPLPKAKPGTHLPQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDLPATEQKENCLDCYMDPLRLSLLPPRARKPVCPPSLCSSVITIGDLVLDSDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCRDSSRPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECSIT, CT (ECSIT, Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial, Protein SITPEC) (MaxLight 490)
MBS6294286-01 0.1 mL

ECSIT, CT (ECSIT, Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial, Protein SITPEC) (MaxLight 490)

Sign In for Pricing
View Details
ECSIT, CT (ECSIT, Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial, Protein SITPEC) (MaxLight 490)
MBS6294286-02 5x 0.1 mL

ECSIT, CT (ECSIT, Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial, Protein SITPEC) (MaxLight 490)

Sign In for Pricing
View Details
HUWE1 Rabbit Polyclonal Antibody
E10G12815 100 µL

HUWE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAT2B Antibody - N-terminal region
OAEB02993-100UG 100 µg

MAT2B Antibody - N-terminal region

Sign In for Pricing
View Details
A330021E22Rik Protein Vector (Mouse) (pPM-C-His)
PV150617 500 ng

A330021E22Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
REG1 alpha (REG1A) Mouse Monoclonal Antibody [Clone:1E12]
E45M21336 100 µg

REG1 alpha (REG1A) Mouse Monoclonal Antibody [Clone:1E12]

Sign In for Pricing
View Details