Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTKN Rabbit pAb (APR26796N)

Product Specifications

Background

This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RTKN Rabbit pAb (APR26796N) .

Synonyms

RTKN; rhotekin

Gene ID

6242

UniProt

Q9BST9

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/61kDa/62kDa Observed MW: 63kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6242

Uniprot URL

https://www.uniprot.org/uniprot/Q9BST9

AA Sequence

PLCMTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIMKIETPAPRKPPQALAKQGSLYHEMAIEPLDDIAAVTDILTQREGARLETPPPWLAMFTDQPALPNPCSPASVAPAPDWTHPLPWGRPRTFSLDAVPPDHSPRARSVAPLPPQRSPRTRGLCSKGQPRTWLQSPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Ethyl-N- (2-hydroxyethyl) -p-phenylenediamine sulfate salt
sc-228706 25 g

N-Ethyl-N- (2-hydroxyethyl) -p-phenylenediamine sulfate salt

Sign In for Pricing
View Details
Mouse ATPase family AAA domain containing protein 1 (ATAD1) ELISA kit
GTR10419121 96 Well

Mouse ATPase family AAA domain containing protein 1 (ATAD1) ELISA kit

Sign In for Pricing
View Details
USP21 Rabbit Polyclonal Antibody
TA365487 100 µL

USP21 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cxcl2 (NM_009140) Mouse Tagged ORF Clone Lentiviral Particle
MR223092L3V 200 µL

Cxcl2 (NM_009140) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Pon l 7
ra-3234A 100 µg

Recombinant Pon l 7

Sign In for Pricing
View Details
BUP-1 (F-11) Alexa Fluor® 647
sc-374066 AF647 200 µg/mL

BUP-1 (F-11) Alexa Fluor® 647

Sign In for Pricing
View Details