Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPA3 Rabbit pAb (APR26785N)

Product Specifications

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPA3 Rabbit pAb (APR26785N) .

Synonyms

RPA3; REPA3; RP-A p14; RP-Ap14

Gene ID

6119

UniProt

P35244

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 16kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6119

Uniprot URL

https://www.uniprot.org/uniprot/P35244

AA Sequence

DLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQHD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri dcuA Protein (aa 1-433)
VAng-Lsx07694-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Flexneri dcuA Protein (aa 1-433)

Sign In for Pricing
View Details
Whale NIS Stable Expressing HeLa Cell Line
T6492 1x106 cells / 1.0 mL

Whale NIS Stable Expressing HeLa Cell Line

Sign In for Pricing
View Details
PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (MaxLight 550)
MBS6388455-01 0.1 mL

PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (MaxLight 550)

Sign In for Pricing
View Details
PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (MaxLight 550)
MBS6388455-02 5x 0.1 mL

PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (MaxLight 550)

Sign In for Pricing
View Details
Prion protein PrP (PRNP) chicken polyclonal antibody
CH23027-200 200 µL

Prion protein PrP (PRNP) chicken polyclonal antibody

Sign In for Pricing
View Details
RING Finger Protein 135 (RNF135, E3 Ubiquitin-protein Ligase RNF135, L13, MMFD, RIG-I E3 Ubiquitin Ligase, REUL, Riplet) (Biotin)
132650-Biotin 100 µL

RING Finger Protein 135 (RNF135, E3 Ubiquitin-protein Ligase RNF135, L13, MMFD, RIG-I E3 Ubiquitin Ligase, REUL, Riplet) (Biotin)

Sign In for Pricing
View Details