Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RECK Rabbit pAb (APR26782N)

Product Specifications

Background

The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RECK Rabbit pAb (APR26782N) .

Synonyms

RECK; ST15

Gene ID

8434

UniProt

O95980

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 106kDa Observed MW: 106kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8434

Uniprot URL

https://www.uniprot.org/uniprot/O95980

AA Sequence

ALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZNF385C shRNA (UAS) - Lentiviral human ZNF385C shRNA (UAS) plasmid
GTR15352150 1 Vial

Lentiviral human ZNF385C shRNA (UAS) - Lentiviral human ZNF385C shRNA (UAS) plasmid

Sign In for Pricing
View Details
Tctex1d4 (NM_175030) Mouse Tagged ORF Clone Lentiviral Particle
MR220488L4V 200 µL

Tctex1d4 (NM_175030) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Active Recombinant Rat Cd70 protein, hFc-tagged
Cd70-8730R 50 µg

Active Recombinant Rat Cd70 protein, hFc-tagged

Sign In for Pricing
View Details
Prr15l sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4117603 1.0 µg DNA

Prr15l sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rat Monoclonal CD3 Antibody (17A2) [Janelia Fluor 525]
FAB4841JF525 0.1 mL

Rat Monoclonal CD3 Antibody (17A2) [Janelia Fluor 525]

Sign In for Pricing
View Details
4-Bromo-4'- (cyclopentyloxy) biphenyl
431068-01 100 mg

4-Bromo-4'- (cyclopentyloxy) biphenyl

Sign In for Pricing
View Details