Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2A Catalytic α Rabbit pAb (APR26766N)

Product Specifications

Background

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP2A Catalytic α Rabbit pAb (APR26766N) .

Synonyms

PPP2CA; PP2Ac; PP2CA; PP2Calpha; RP-C

Gene ID

5515

UniProt

P67775

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle pole

Applications

WB (143B, MNNG, Sus scrofa, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/35kDa Observed MW: 36KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5515

Uniprot URL

https://www.uniprot.org/uniprot/P67775

AA Sequence

MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (B-Cell Marker) (rLLC/3777), CF405S conjugate, 0.1mg/mL
BNC043777-100 1x 100 µL

Human Lambda Light Chain (B-Cell Marker) (rLLC/3777), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Josephin 1 (JOSD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]
TA502210BM 100 µL

Josephin 1 (JOSD1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B11]

Sign In for Pricing
View Details
1-(3-(2-Hydroxypropan-2-yl)phenyl)ethanone
TRC-H853270-500MG 500 mg

1-(3-(2-Hydroxypropan-2-yl)phenyl)ethanone

Sign In for Pricing
View Details
Tissue FFPE Sections, Liver
CS704334 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), Biotin conjugate, 0.1mg/mL
BNCB0502-500 1x 500 µL

Human Papillomavirus 16 (HPV-16) (CAMVIR-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lats2 Mouse Gene Knockout Kit (CRISPR)
KN309148 1 Kit

Lats2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details