Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PP2A Catalytic α Rabbit pAb (APR26766N)

Product Specifications

Background

This gene encodes the phosphatase 2A catalytic subunit. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. This gene encodes an alpha isoform of the catalytic subunit.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PP2A Catalytic α Rabbit pAb (APR26766N) .

Synonyms

PPP2CA; PP2Ac; PP2CA; PP2Calpha; RP-C

Gene ID

5515

UniProt

P67775

Cellular Locus

Chromosome, Cytoplasm, Nucleus, centromere, cytoskeleton, spindle pole

Applications

WB (143B, MNNG, Sus scrofa, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/35kDa Observed MW: 36KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5515

Uniprot URL

https://www.uniprot.org/uniprot/P67775

AA Sequence

MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Six3 Mouse Gene Knockout Kit (CRISPR)
KN515813 1 Kit

Six3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF740 conjugate, 0.1mg/mL
BNC740385-500 1x 500 µL

CD3e (Rabbit PAb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N 100 µg

TNF alpha (TNF) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF568 conjugate, 0.1mg/mL
BNC682055-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calprotectin (S100A9) (NM_002965) Human Over-expression Lysate
LC401037 20 µg

Calprotectin (S100A9) (NM_002965) Human Over-expression Lysate

Sign In for Pricing
View Details
EnzyChrom™ Monoamine Oxidase Assay Kit
EMAO-100 100 Tests

EnzyChrom™ Monoamine Oxidase Assay Kit

Sign In for Pricing
View Details