Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R8 Rabbit pAb (APR26765N)

Product Specifications

Background

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPP1R8 Rabbit pAb (APR26765N) .

Synonyms

PPP1R8; ARD-1; ARD1; NIPP-1; NIPP1; PRO2047

Gene ID

5511

UniProt

Q12972

Cellular Locus

Cytoplasm, Nucleus, Nucleus speckle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/22kDa/38kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5511

Uniprot URL

https://www.uniprot.org/uniprot/Q12972

AA Sequence

MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR3GL (Center) Rabbit Polyclonal Antibody
AP53388PU-N 400 µL

POLR3GL (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS806014 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
NIPP1 (PPP1R8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]
TA804808AM 100 µL

NIPP1 (PPP1R8) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL
BNC470826-500 1x 500 µL

Ep-CAM / CD326 (EGP40/826), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ZNF499 (ZBTB45) activation kit by CRISPRa
GA113734 1 Kit

Human ZNF499 (ZBTB45) activation kit by CRISPRa

Sign In for Pricing
View Details
5-Indanol
TRC-I499850-1G 1 g

5-Indanol

Sign In for Pricing
View Details