Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1R8 Rabbit pAb (APR26765N)

Product Specifications

Background

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PPP1R8 Rabbit pAb (APR26765N) .

Synonyms

PPP1R8; ARD-1; ARD1; NIPP-1; NIPP1; PRO2047

Gene ID

5511

UniProt

Q12972

Cellular Locus

Cytoplasm, Nucleus, Nucleus speckle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa/22kDa/38kDa Observed MW: 40kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5511

Uniprot URL

https://www.uniprot.org/uniprot/Q12972

AA Sequence

MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF594 conjugate, 0.1mg/mL
BNC942183-100 1x 100 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLTCL1 Antibody (Biotin)
KB-17742-01 50 μL

CLTCL1 Antibody (Biotin)

Sign In for Pricing
View Details
CLTCL1 Antibody (Biotin)
KB-17742-02 100 µL

CLTCL1 Antibody (Biotin)

Sign In for Pricing
View Details
CLTCL1 Antibody (Biotin)
KB-17742-03 1 mL

CLTCL1 Antibody (Biotin)

Sign In for Pricing
View Details
BDH1 Mouse Monoclonal Antibody [Clone ID: 1A5]
AM06382SU-N 100 µL

BDH1 Mouse Monoclonal Antibody [Clone ID: 1A5]

Sign In for Pricing
View Details
4,4-Dichlorodiphenyl Sulfone
TRC-D434165-1G 1 g

4,4-Dichlorodiphenyl Sulfone

Sign In for Pricing
View Details