Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MLPH Rabbit pAb (APR26725N)

Product Specifications

Background

This gene encodes a member of the exophilin subfamily of Rab effector proteins. The protein forms a ternary complex with the small Ras-related GTPase Rab27A in its GTP-bound form and the motor protein myosin Va. A similar protein complex in mouse functions to tether pigment-producing organelles called melanosomes to the actin cytoskeleton in melanocytes, and is required for visible pigmentation in the hair and skin. A mutation in this gene results in Griscelli syndrome type 3, which is characterized by a silver-gray hair color and abnormal pigment distribution in the hair shaft. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MLPH Rabbit pAb (APR26725N) .

Synonyms

MLPH; SLAC2-A

Gene ID

79083

UniProt

Q9BV36

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 50kDa/52kDa/60kDa/62kDa/65kDa Observed MW: 75kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=79083

Uniprot URL

https://www.uniprot.org/uniprot/Q9BV36

AA Sequence

EQLPLQYLADVDTSDEESIRAHVMASHHSKRRGRASSESQIFELNKHISAVECLLTYLENTVVPPLAKGLGAGVRTEADVEEEALRRKLEELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVGTAAHQTNRQEKSPQDPGDPVQYNRTTDEELSELEDRVAVTASEVQQAESEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFLPRVAGKLGKRPEDPNADPSSEAKAMAVPYLLRRKFSNSLKSQGKDDDSFDRKSVYRGSLTQRNPNARKGMASHTFAKPVVAHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-15 -Interleukin 15- CLIA Kit
E-CL-R0398-01 24 Tests

Rat IL-15 -Interleukin 15- CLIA Kit

Sign In for Pricing
View Details
Rat IL-15 -Interleukin 15- CLIA Kit
E-CL-R0398-02 48 Tests

Rat IL-15 -Interleukin 15- CLIA Kit

Sign In for Pricing
View Details
Rat IL-15 -Interleukin 15- CLIA Kit
E-CL-R0398-03 96 Tests

Rat IL-15 -Interleukin 15- CLIA Kit

Sign In for Pricing
View Details
Rat IL-15 -Interleukin 15- CLIA Kit
E-CL-R0398-04 5x 96 Tests

Rat IL-15 -Interleukin 15- CLIA Kit

Sign In for Pricing
View Details
Rat IL-15 -Interleukin 15- CLIA Kit
E-CL-R0398-05 10x 96 Tests

Rat IL-15 -Interleukin 15- CLIA Kit

Sign In for Pricing
View Details
Alcohol Burner, Glass
2066750/3 1 Each

Alcohol Burner, Glass

Sign In for Pricing
View Details