Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Rabbit pAb (APR26690N)

Product Specifications

Background

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HOXB1 Rabbit pAb (APR26690N) .

Synonyms

HOXB1; HCFP3; HOX2; HOX2I; Hox-2.9

Gene ID

3211

UniProt

P14653

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa/32kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3211

Uniprot URL

https://www.uniprot.org/uniprot/P14653

AA Sequence

SAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGVPFPSSAPSGYAPAACSPSYGPSQYYPLGQSEGDGGYFHPSSYGAQLGGLSDGYGAGGAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iba1 Recombinant Rabbit monoclonal Antibody
HA750440 100 µL

Iba1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
EMA (MUC1) (NM_002456) Human Over-expression Lysate
LY400880 100 µg

EMA (MUC1) (NM_002456) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700576 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit
RDR-ESAM-Hu-01 96 Tests

Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit

Sign In for Pricing
View Details
Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit
RDR-ESAM-Hu-02 48 Tests

Human Endothelial Cell Adhesion Molecule (ESAM) ELISA Kit

Sign In for Pricing
View Details
1-Stearoyl-2-linoleoyl-sn-glycero-3-phosphate Sodium Salt
TRC-S561050-25MG 25 mg

1-Stearoyl-2-linoleoyl-sn-glycero-3-phosphate Sodium Salt

Sign In for Pricing
View Details