Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] Histone H2A.Z Rabbit pAb (APR26685N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Histone H2A.Z Rabbit pAb (APR26685N) .

Synonyms

H2AFZ; H2A.Z-1; H2A.z; H2A/z; H2AZ; histone H2A.Z

Gene ID

3015

UniProt

P0C0S5

Cellular Locus

Chromosome, Nucleus

Applications

IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3015

Uniprot URL

https://www.uniprot.org/uniprot/P0C0S5

AA Sequence

MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella paratyphi A Putative multidrug resistance protein MdtD (mdtD), partial
MBS1032481-01 1 mg (E-Coli)

Recombinant Salmonella paratyphi A Putative multidrug resistance protein MdtD (mdtD), partial

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Putative multidrug resistance protein MdtD (mdtD), partial
MBS1032481-02 1 mg (Yeast)

Recombinant Salmonella paratyphi A Putative multidrug resistance protein MdtD (mdtD), partial

Sign In for Pricing
View Details
GULP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0922005 3x 1.0 µg

GULP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Human DNA polymerase zeta catalytic subunit, REV3L ELISA Kit
MBS1611438-01 48 Well

Human DNA polymerase zeta catalytic subunit, REV3L ELISA Kit

Sign In for Pricing
View Details
Human DNA polymerase zeta catalytic subunit, REV3L ELISA Kit
MBS1611438-02 96 Well

Human DNA polymerase zeta catalytic subunit, REV3L ELISA Kit

Sign In for Pricing
View Details
Human DNA polymerase zeta catalytic subunit, REV3L ELISA Kit
MBS1611438-03 5x 96 Well

Human DNA polymerase zeta catalytic subunit, REV3L ELISA Kit

Sign In for Pricing
View Details