Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] Histone H2A.Z Rabbit pAb (APR26685N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Histone H2A.Z Rabbit pAb (APR26685N) .

Synonyms

H2AFZ; H2A.Z-1; H2A.z; H2A/z; H2AZ; histone H2A.Z

Gene ID

3015

UniProt

P0C0S5

Cellular Locus

Chromosome, Nucleus

Applications

IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 13kDa Observed MW: 15kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3015

Uniprot URL

https://www.uniprot.org/uniprot/P0C0S5

AA Sequence

MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Liver Carboxylesterase 1 (CES1) (NM_001266) Human Tagged Lenti ORF Clone
RC220398L3 10 µg

Liver Carboxylesterase 1 (CES1) (NM_001266) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
FABP5P4 ORF Vector (Human) (pORF)
ORF019116 1.0 µg DNA

FABP5P4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (MaxLight 650)
134265-ML650 100 µL

TBX22 (T-box Transcription Factor TBX22, T-box Protein 22, TBOX22) (MaxLight 650)

Sign In for Pricing
View Details
MORC3 Polyclonal Conjugated Antibody
MBS9440553-01 0.1 mL (Biotin)

MORC3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MORC3 Polyclonal Conjugated Antibody
MBS9440553-02 0.1 mL (AF350)

MORC3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MORC3 Polyclonal Conjugated Antibody
MBS9440553-03 0.1 mL (AF405)

MORC3 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details