Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT3 Rabbit pAb (APR26669N)

Product Specifications

Background

This gene encodes UDP-GalNAc transferase 3, a member of the GalNAc-transferases family. This family transfers an N-acetyl galactosamine to the hydroxyl group of a serine or threonine residue in the first step of O-linked oligosaccharide biosynthesis. Individual GalNAc-transferases have distinct activities and initiation of O-glycosylation is regulated by a repertoire of GalNAc-transferases. The protein encoded by this gene is highly homologous to other family members, however the enzymes have different substrate specificities.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GALNT3 Rabbit pAb (APR26669N) .

Synonyms

GALNT3; GalNAc-T3; HFTC; HHS

Gene ID

2591

UniProt

Q14435

Cellular Locus

Golgi apparatus, Golgi stack membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/72kDa Observed MW: 73kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2591

Uniprot URL

https://www.uniprot.org/uniprot/Q14435

AA Sequence

MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBS6 Lentiviral Activation Particles (m)
sc-425572-LAC 200 µL

BBS6 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
L-Alanine 4-nitroanilide hydrochloride
TSW-00865-01 100 mg

L-Alanine 4-nitroanilide hydrochloride

Sign In for Pricing
View Details
L-Alanine 4-nitroanilide hydrochloride
TSW-00865-02 250 mg

L-Alanine 4-nitroanilide hydrochloride

Sign In for Pricing
View Details
L-Alanine 4-nitroanilide hydrochloride
TSW-00865-03 50 mg

L-Alanine 4-nitroanilide hydrochloride

Sign In for Pricing
View Details
ERF3B, ID (GSPT2, ERF3B, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition protein 2 homolog) (APC)
MBS6296460-01 0.2 mL

ERF3B, ID (GSPT2, ERF3B, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition protein 2 homolog) (APC)

Sign In for Pricing
View Details
ERF3B, ID (GSPT2, ERF3B, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition protein 2 homolog) (APC)
MBS6296460-02 5x 0.2 mL

ERF3B, ID (GSPT2, ERF3B, Eukaryotic peptide chain release factor GTP-binding subunit ERF3B, G1 to S phase transition protein 2 homolog) (APC)

Sign In for Pricing
View Details