Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2D Rabbit pAb (APR26633N)

Product Specifications

Background

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDKN2D Rabbit pAb (APR26633N) .

Synonyms

CDKN2D; INK4D; p19; p19-INK4D

Gene ID

1032

UniProt

P55273

Cellular Locus

Cytoplasm, Nucleus

Dilution

IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: Refer to figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1032

Uniprot URL

https://www.uniprot.org/uniprot/P55273

AA Sequence

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH3B Antibody
CSB-PA597290-01 50 μL

IDH3B Antibody

Sign In for Pricing
View Details
IDH3B Antibody
CSB-PA597290-02 100 µL

IDH3B Antibody

Sign In for Pricing
View Details
Rabbit Synembryn-A (RIC8A) ELISA Kit
MBS7220833-01 48 Well

Rabbit Synembryn-A (RIC8A) ELISA Kit

Sign In for Pricing
View Details
Rabbit Synembryn-A (RIC8A) ELISA Kit
MBS7220833-02 96 Well

Rabbit Synembryn-A (RIC8A) ELISA Kit

Sign In for Pricing
View Details
Rabbit Synembryn-A (RIC8A) ELISA Kit
MBS7220833-03 5x 96 Well

Rabbit Synembryn-A (RIC8A) ELISA Kit

Sign In for Pricing
View Details
Rabbit Synembryn-A (RIC8A) ELISA Kit
MBS7220833-04 10x 96 Well

Rabbit Synembryn-A (RIC8A) ELISA Kit

Sign In for Pricing
View Details