Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD207 Rabbit pAb (APR26630N)

Product Specifications

Background

The protein encoded by this gene is expressed only in Langerhans cells which are immature dendritic cells of the epidermis and mucosa. It is localized in the Birbeck granules, organelles present in the cytoplasm of Langerhans cells and consisting of superimposed and zippered membranes. It is a C-type lectin with mannose binding specificity, and it has been proposed that mannose binding by this protein leads to internalization of antigen into Birbeck granules and providing access to a nonclassical antigen-processing pathway. Mutations in this gene result in Birbeck granules deficiency or loss of sugar binding activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD207 Rabbit pAb (APR26630N) .

Synonyms

CD207; CLEC4K

Gene ID

50489

UniProt

Q9UJ71

Cellular Locus

Membrane, Single-pass type II membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 36kDa Observed MW: 40-50KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=50489

Uniprot URL

https://www.uniprot.org/uniprot/Q9UJ71

AA Sequence

GTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxidase Anti-Peroxidase (PAP) Soluble Immune Complex
MBS653662-01 1 mL

Peroxidase Anti-Peroxidase (PAP) Soluble Immune Complex

Sign In for Pricing
View Details
Peroxidase Anti-Peroxidase (PAP) Soluble Immune Complex
MBS653662-02 5x 1 mL

Peroxidase Anti-Peroxidase (PAP) Soluble Immune Complex

Sign In for Pricing
View Details
Tpd52 (NM_001025264) Mouse Tagged ORF Clone
MG215226 10 µg

Tpd52 (NM_001025264) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MYLK3 (Myosin Light Chain Kinase 3, MLCK, MLCK2, caMLCK (MaxLight 490)
MBS6447818-01 0.1 mL

MYLK3 (Myosin Light Chain Kinase 3, MLCK, MLCK2, caMLCK (MaxLight 490)

Sign In for Pricing
View Details
MYLK3 (Myosin Light Chain Kinase 3, MLCK, MLCK2, caMLCK (MaxLight 490)
MBS6447818-02 5x 0.1 mL

MYLK3 (Myosin Light Chain Kinase 3, MLCK, MLCK2, caMLCK (MaxLight 490)

Sign In for Pricing
View Details
OR5P2 Double Nickase Plasmid (h2)
sc-414148-NIC-2 20 µg

OR5P2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details