Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCT3 Rabbit pAb (APR26624N)

Product Specifications

Background

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC) . This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCT3 Rabbit pAb (APR26624N) .

Synonyms

CCT3; CCT-gamma; CCTG; PIG48; TCP-1-gamma; TRIC5

Gene ID

7203

UniProt

P49368

Cellular Locus

Cytoplasm

Applications

WB (Homo sapiens, Mus musculus, Rattus norvegicus) IHC (Homo sapiens) IF (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/60kDa Observed MW: 60kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7203

Uniprot URL

https://www.uniprot.org/uniprot/P49368

AA Sequence

MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLA

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Msln shRNA (UAS) - Lentiviral mouse Msln shRNA (UAS, RFP) (25)
GTR15113531 1 Vial

Lentiviral mouse Msln shRNA (UAS) - Lentiviral mouse Msln shRNA (UAS, RFP) (25)

Ask
View Details
Rat Chml Pre-designed siRNA Set B
SI202699B 1 Each

Rat Chml Pre-designed siRNA Set B

Ask
View Details
Cnnm4 (NM_001271050) Rat Tagged ORF Clone
RR217195 10 µg

Cnnm4 (NM_001271050) Rat Tagged ORF Clone

Ask
View Details
Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (MaxLight 405)
MBS6193616-01 0.1 mL

Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (MaxLight 405)

Ask
View Details
Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (MaxLight 405)
MBS6193616-02 5x 0.1 mL

Bcl-X (Apoptosis regulator Bcl-X, B cell lymphoma 2 like, BCL XL/S, Bcl-2-like protein 1, Bcl2-L-1, BCL2L, Bcl2l1, BCLX, BclXL, BclXs, Protein phosphatase 1 regulatory subunit 52 (PPP1R52)) (MaxLight 405)

Ask
View Details