Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANLN Rabbit pAb (APR26602N)

Product Specifications

Background

This gene encodes an actin-binding protein that plays a role in cell growth and migration, and in cytokinesis. The encoded protein is thought to regulate actin cytoskeletal dynamics in podocytes, components of the glomerulus. Mutations in this gene are associated with focal segmental glomerulosclerosis 8. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ANLN Rabbit pAb (APR26602N) .

Synonyms

ANLN; FSGS8; Scraps; scra; anillin

Gene ID

54443

UniProt

Q9NQW6

Cellular Locus

Cytoplasm, Nucleus, cell cortex, cytoskeleton

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 120kDa/124kDa Observed MW: 120kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=54443

Uniprot URL

https://www.uniprot.org/uniprot/Q9NQW6

AA Sequence

ATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLDKVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP12A Human Gene Knockout Kit (CRISPR)
KN420908 1 Kit

ATP12A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS628024 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF640R conjugate, 0.1mg/mL
BNC402868-100 1x 100 µL

Serum Amyloid A (SAA/2868R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), 0.2mg/mL
BNUB1782-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1782), 0.2mg/mL

Sign In for Pricing
View Details
CPA2 Antibody
KC-7655-01 50 μL

CPA2 Antibody

Sign In for Pricing
View Details
CPA2 Antibody
KC-7655-02 100 µL

CPA2 Antibody

Sign In for Pricing
View Details