Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCC11 Rabbit pAb (APR26592N)

Product Specifications

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White) . This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ABCC11 Rabbit pAb (APR26592N) .

Synonyms

ABCC11; EWWD; MRP8; WW

Gene ID

85320

UniProt

Q96J66

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 150kDa/154kDa Observed MW: 128kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=85320

Uniprot URL

https://www.uniprot.org/uniprot/Q96J66

AA Sequence

MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPPWGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC13B Human Gene Knockout Kit (CRISPR)
KN419186 1 Kit

UNC13B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Polyclonal Antibody to Human IgM
PA-2102-1 1 mL

Horseradish Peroxidase Conjugated Goat Polyclonal Antibody to Human IgM

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR566337 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Human IMPACT activation kit by CRISPRa
GA110739 1 Kit

Human IMPACT activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565843 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
BMP5 Rabbit Polyclonal Antibody
TA372126 100 µL

BMP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details