Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3K Rabbit pAb (APR26558N)

Product Specifications

Background

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality POLR3K Rabbit pAb (APR26558N) .

Synonyms

POLR3K; C11; C11-RNP3; My010; RPC10; RPC11; RPC12.5

Gene ID

51728

UniProt

Q9Y2Y1

Cellular Locus

Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51728

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y2Y1

AA Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SALL1, NT (SALL1, SAL1, ZNF794, Sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1) (MaxLight 550) discontinued
041384-ML550 100 µL

SALL1, NT (SALL1, SAL1, ZNF794, Sal-like protein 1, Spalt-like transcription factor 1, Zinc finger protein 794, Zinc finger protein SALL1, Zinc finger protein Spalt-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Lipopolysaccharide-induced CXC Chemokine (LIX) (MaxLight 750) discontinued
L2526-01-ML750 100 µL

Lipopolysaccharide-induced CXC Chemokine (LIX) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MRPL19 Polyclonal Antibody, FITC Conjugated
A53779-100 100 µL

MRPL19 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal CD84/SLAMF5 Antibody (153-4D9) [Janelia Fluor 549]
NBP3-11578JF549 0.1 mL

Mouse Monoclonal CD84/SLAMF5 Antibody (153-4D9) [Janelia Fluor 549]

Sign In for Pricing
View Details
D3DR Antibody
C30226-01 50 μL

D3DR Antibody

Sign In for Pricing
View Details
D3DR Antibody
C30226-02 100 µL

D3DR Antibody

Sign In for Pricing
View Details