Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3K Rabbit pAb (APR26558N)

Product Specifications

Background

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality POLR3K Rabbit pAb (APR26558N) .

Synonyms

POLR3K; C11; C11-RNP3; My010; RPC10; RPC11; RPC12.5

Gene ID

51728

UniProt

Q9Y2Y1

Cellular Locus

Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51728

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y2Y1

AA Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP8 Rabbit Polyclonal Antibody
E10G01239 100 µL

RBBP8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFNA5 Polyclonal Antibody
E44H07827 100 µL

IFNA5 Polyclonal Antibody

Sign In for Pricing
View Details
HXA2 discontinued
537639-01 30ul

HXA2 discontinued

Sign In for Pricing
View Details
HXA2 discontinued
537639-02 100 µL

HXA2 discontinued

Sign In for Pricing
View Details
USP4, CT (Ubiquitin Carboxyl-terminal Hydrolase 4, Ubiquitin Thiolesterase 4, Ubiquitin Specific-processing Protease 4, Deubiquitinating Enzyme 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (MaxLight 490) discontinued
U4099-85A-ML490 100 µL

USP4, CT (Ubiquitin Carboxyl-terminal Hydrolase 4, Ubiquitin Thiolesterase 4, Ubiquitin Specific-processing Protease 4, Deubiquitinating Enzyme 4, Ubiquitous Nuclear Protein Homolog, UNP, UNPH) (MaxLight 490) discontinued

Sign In for Pricing
View Details
22cm Spacers - 1.5mm thick
VS30S15 1 Each

22cm Spacers - 1.5mm thick

Sign In for Pricing
View Details