Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3K Rabbit pAb (APR26558N)

Product Specifications

Background

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality POLR3K Rabbit pAb (APR26558N) .

Synonyms

POLR3K; C11; C11-RNP3; My010; RPC10; RPC11; RPC12.5

Gene ID

51728

UniProt

Q9Y2Y1

Cellular Locus

Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 12kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51728

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y2Y1

AA Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1C, CT (CD1C, T-cell surface glycoprotein CD1c, CD1c) (MaxLight 490)
MBS6282878-01 0.1 mL

CD1C, CT (CD1C, T-cell surface glycoprotein CD1c, CD1c) (MaxLight 490)

Sign In for Pricing
View Details
CD1C, CT (CD1C, T-cell surface glycoprotein CD1c, CD1c) (MaxLight 490)
MBS6282878-02 5x 0.1 mL

CD1C, CT (CD1C, T-cell surface glycoprotein CD1c, CD1c) (MaxLight 490)

Sign In for Pricing
View Details
COX6CP5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV759249 1.0 µg DNA

COX6CP5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Conjugated Homer1 Rabbit mAb
C57122 100 µL

Conjugated Homer1 Rabbit mAb

Sign In for Pricing
View Details
Rabbit Polyclonal SETD3 Antibody [Alexa Fluor 700]
NBP2-32137AF700 0.1 mL

Rabbit Polyclonal SETD3 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
P4HB Rabbit mAb Antibody
orb3015056 100 µL

P4HB Rabbit mAb Antibody

Sign In for Pricing
View Details