Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1D Rabbit pAb (APR26540N)

Product Specifications

Background

The protein encoded by this gene is a DNA binding and apoptosis-inducing protein and is localized in the nucleus. It is also a Rac3-interacting protein which acts as a corepressor for the thyroid hormone receptor. This protein is thought to regulate TRAX/Translin complex formation. Alternate splicing results in multiple transcript variants that encode the same protein. Multiple pseudogenes of this gene are found on chromosome 10.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality C1D Rabbit pAb (APR26540N) .

Synonyms

C1D; LRP1; Rrp47; SUN-CoR; SUNCOR; hC1D

Gene ID

10438

UniProt

Q13901

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 16kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10438

Uniprot URL

https://www.uniprot.org/uniprot/Q13901

AA Sequence

MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVANKGKSKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Serpin A3-5 (SERPINA3-5)
CSB-YP382675BO-01 20 µg

Recombinant Bovine Serpin A3-5 (SERPINA3-5)

Sign In for Pricing
View Details
Recombinant Bovine Serpin A3-5 (SERPINA3-5)
CSB-YP382675BO-02 100 µg

Recombinant Bovine Serpin A3-5 (SERPINA3-5)

Sign In for Pricing
View Details
Recombinant Bovine Serpin A3-5 (SERPINA3-5)
CSB-YP382675BO-03 1 mg

Recombinant Bovine Serpin A3-5 (SERPINA3-5)

Sign In for Pricing
View Details
Anti-SLAMF7 / CS1
A3062-1mg*25 25x 1 mg

Anti-SLAMF7 / CS1

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) Os02g0504800 Polyclonal Antibody
MBS7178397 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) Os02g0504800 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Nmur1 ELISA Kit
EF014049 96 Tests

Mouse Nmur1 ELISA Kit

Sign In for Pricing
View Details