Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPG Rabbit pAb (APR26525N)

Product Specifications

Background

This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NAPG Rabbit pAb (APR26525N) .

Synonyms

NAPG; GAMMASNAP

Gene ID

8774

UniProt

Q99747

Cellular Locus

Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/34kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8774

Uniprot URL

https://www.uniprot.org/uniprot/Q99747

AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF405S conjugate, 0.1mg/mL
BNC043247-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3247), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNase I (DNASE1) (NM_005223) Human Over-expression Lysate
LC401601 20 µg

DNase I (DNASE1) (NM_005223) Human Over-expression Lysate

Sign In for Pricing
View Details
PIP4K2C (NM_001146259) Human Over-expression Lysate
LC431351 20 µg

PIP4K2C (NM_001146259) Human Over-expression Lysate

Sign In for Pricing
View Details
CDCA8 (1-280) Mouse Monoclonal Antibody [Clone ID: 1D11]
AM26649AF-N 100 µL

CDCA8 (1-280) Mouse Monoclonal Antibody [Clone ID: 1D11]

Sign In for Pricing
View Details
Prpsap2 Mouse Gene Knockout Kit (CRISPR)
KN513986 1 Kit

Prpsap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AREB6 (ZEB1) (NM_030751) Human Over-expression Lysate
LY403073 100 µg

AREB6 (ZEB1) (NM_030751) Human Over-expression Lysate

Sign In for Pricing
View Details