Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPG Rabbit pAb (APR26525N)

Product Specifications

Background

This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NAPG Rabbit pAb (APR26525N) .

Synonyms

NAPG; GAMMASNAP

Gene ID

8774

UniProt

Q99747

Cellular Locus

Membrane, Peripheral membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/34kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8774

Uniprot URL

https://www.uniprot.org/uniprot/Q99747

AA Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Adamts19 Pre-designed siRNA Set B
SI200258B 1 Each

Rat Adamts19 Pre-designed siRNA Set B

Sign In for Pricing
View Details
JNK1/2/3 (phospho-T183) polyclonal antibody
E43S4763 100 µL

JNK1/2/3 (phospho-T183) polyclonal antibody

Sign In for Pricing
View Details
MAGP1 (MFAP2) (NM_017459) Human Tagged ORF Clone
RG202188 10 µg

MAGP1 (MFAP2) (NM_017459) Human Tagged ORF Clone

Sign In for Pricing
View Details
16kg Capacity Orbital Shaker
SHA6002 1 Each

16kg Capacity Orbital Shaker

Sign In for Pricing
View Details
COASY Human Over-expression Lysate
orb1364288 20 µg

COASY Human Over-expression Lysate

Sign In for Pricing
View Details
SP140 (NM_001278451) Human Tagged ORF Clone
RG239662 10 µg

SP140 (NM_001278451) Human Tagged ORF Clone

Sign In for Pricing
View Details