Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2C2 Rabbit pAb (APR26515N)

Product Specifications

Background

This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NR2C2 Rabbit pAb (APR26515N) .

Synonyms

NR2C2; TAK1; TR4

Gene ID

7182

UniProt

P49116

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa/67kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7182

Uniprot URL

https://www.uniprot.org/uniprot/P49116

AA Sequence

LIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Tlr5 Antibody Picoband®, iFluor647 Conjugate
A00462-2-iFluor647 100 µg

Anti-Tlr5 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Caspase 3 (CASP3) Polyclonal Antibody
CAU27502-01 100 µL

Caspase 3 (CASP3) Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 3 (CASP3) Polyclonal Antibody
CAU27502-02 200 µL

Caspase 3 (CASP3) Polyclonal Antibody

Sign In for Pricing
View Details
Caspase 3 (CASP3) Polyclonal Antibody
CAU27502-03 1 mL

Caspase 3 (CASP3) Polyclonal Antibody

Sign In for Pricing
View Details
Solute Carrier family 4, anion exchanger, member 1 (erythrocyte Membrane Protein band 3, Diego blood group)
335135 100 µL

Solute Carrier family 4, anion exchanger, member 1 (erythrocyte Membrane Protein band 3, Diego blood group)

Sign In for Pricing
View Details
TFEC Antibody
orb1327183 100 µg

TFEC Antibody

Sign In for Pricing
View Details