Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2C2 Rabbit pAb (APR26515N)

Product Specifications

Background

This gene encodes a protein that belongs to the nuclear hormone receptor family. Members of this family act as ligand-activated transcription factors and function in many biological processes such as development, cellular differentiation and homeostasis. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes. The protein encoded by this gene plays a role in protecting cells from oxidative stress and damage induced by ionizing radiation. The lack of a similar gene in mouse results in growth retardation, severe spinal curvature, subfertility, premature aging, and prostatic intraepithelial neoplasia (PIN) development. Alternative splicing results in multiple transcript variants encoding different isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NR2C2 Rabbit pAb (APR26515N) .

Synonyms

NR2C2; TAK1; TR4

Gene ID

7182

UniProt

P49116

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 65kDa/67kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7182

Uniprot URL

https://www.uniprot.org/uniprot/P49116

AA Sequence

LIATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK4 (Cyclin-Dependent Kinase 4, CMM3, MGC14458, PSK-J3) (MaxLight 405) discontinued
244524-ML405 100 µL

CDK4 (Cyclin-Dependent Kinase 4, CMM3, MGC14458, PSK-J3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rho GTPase activating protein 29 Rabbit Polyclonal Antibody (RBITC)
orb1042390 100 µL

Rho GTPase activating protein 29 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
MPP4 shRNA (h) Lentiviral Particles
sc-94843-V 200 µL

MPP4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
FCGR2B Recombinant Protein C-His Tag Lyophilized 20UG
IHUFCGR2BRCHISLY20UG 20 µg

FCGR2B Recombinant Protein C-His Tag Lyophilized 20UG

Sign In for Pricing
View Details
PIM2 (NM_006875) Human Untagged Clone
SC115825 10 µg

PIM2 (NM_006875) Human Untagged Clone

Sign In for Pricing
View Details
ATF2 Polyclonal Antibody
MBS8527385-01 0.1 mL

ATF2 Polyclonal Antibody

Sign In for Pricing
View Details