Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCN1 Rabbit pAb (APR26507N)

Product Specifications

Background

This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This protein is a major constituent of secondary granules in neutrophils and facilitates the transport of cobalamin into cells.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TCN1 Rabbit pAb (APR26507N) .

Synonyms

TCN1; HC; TC-1; TC1; TCI

Gene ID

6947

UniProt

P20061

Cellular Locus

Secreted

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 48kDa Observed MW: 48kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6947

Uniprot URL

https://www.uniprot.org/uniprot/P20061

AA Sequence

EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEISQGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r28 Lentiviral Activation Particles (m2)
sc-437075-LAC-2 200 µL

Vmn2r28 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Lentiviral human NT5C3B shRNA (UAS) - Lentiviral human NT5C3B shRNA (UAS, GFP) plasmid
GTR15347245 1 Vial

Lentiviral human NT5C3B shRNA (UAS) - Lentiviral human NT5C3B shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)
MBS1304298-01 0.02 mg (E-Coli)

Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)
MBS1304298-02 0.1 mg (E-Coli)

Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)
MBS1304298-03 0.02 mg (Yeast)

Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)

Sign In for Pricing
View Details
Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)
MBS1304298-04 0.1 mg (Yeast)

Recombinant Burkholderia pseudomallei Probable rRNA maturation factor (BPSL0672)

Sign In for Pricing
View Details