Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCVRN Rabbit pAb (APR26498N)

Product Specifications

Background

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RCVRN Rabbit pAb (APR26498N) .

Synonyms

RCVRN; RCV1; recoverin

Gene ID

5957

UniProt

P35243

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 23kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5957

Uniprot URL

https://www.uniprot.org/uniprot/P35243

AA Sequence

MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPST (NM_001013440) Human Tagged ORF Clone Lentiviral Particle
RC224963L3V 200 µL

MPST (NM_001013440) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
[N- (2-Maleimidoethyl]diethylenetriaminepentaacetic Acid, Monoamide
sc-218918 10 mg

[N- (2-Maleimidoethyl]diethylenetriaminepentaacetic Acid, Monoamide

Sign In for Pricing
View Details
(5,6) -FAM diacetate NHS ester, 25 mg
2934-25mg 25 mg

(5,6) -FAM diacetate NHS ester, 25 mg

Sign In for Pricing
View Details
CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]
TA506104AM 100 µL

CD45 (PTPRC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D8]

Sign In for Pricing
View Details
ZNF365 Mouse Monoclonal Antibody [Clone ID: OTI9H5]
TA505065 100 µL

ZNF365 Mouse Monoclonal Antibody [Clone ID: OTI9H5]

Sign In for Pricing
View Details
Chicken Pituitary adenylate cyclase activating polypeptide (PACAP) ELISA Kit
AE64536CH-01 48 Tests

Chicken Pituitary adenylate cyclase activating polypeptide (PACAP) ELISA Kit

Sign In for Pricing
View Details