Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCVRN Rabbit pAb (APR26498N)

Product Specifications

Background

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RCVRN Rabbit pAb (APR26498N) .

Synonyms

RCVRN; RCV1; recoverin

Gene ID

5957

UniProt

P35243

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa Observed MW: 23kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5957

Uniprot URL

https://www.uniprot.org/uniprot/P35243

AA Sequence

MGNSKSGALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish Mylpfa mutant Antibody (Dylight488 Conjugate)
DZ41409-Dylight488 200 µL

Anti-Zebrafish Mylpfa mutant Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
RASD2 Antibody
orb673441-01 50 µg

RASD2 Antibody

Sign In for Pricing
View Details
RASD2 Antibody
orb673441-02 100 µg

RASD2 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal UBA52 Antibody [CoraFluor 1]
NB300-263CL1 0.1 mL

Rabbit Polyclonal UBA52 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Human NES/Nestin ELISA Kit
E1733Hu 96 Tests

Human NES/Nestin ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CHCHD3 Antibody
NBP3-38566-100ul 100 µL

Rabbit Polyclonal CHCHD3 Antibody

Sign In for Pricing
View Details