Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP3 Rabbit pAb (APR26497N)

Product Specifications

Background

Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5 kbp in length and consists of four exons separated by three introns. The introns are 1.6-1.9 kbp long. The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da. The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events. In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected. The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long. The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RBP3 Rabbit pAb (APR26497N) .

Synonyms

RBP3; D10S64; D10S65; D10S66; IRBP; RBPI; RP66

Gene ID

5949

UniProt

P10745

Cellular Locus

Secreted, extracellular matrix, extracellular space, interphotoreceptor matrix

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 135kDa Observed MW: 180kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5949

Uniprot URL

https://www.uniprot.org/uniprot/P10745

AA Sequence

GPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHEILSISDPQTLASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRGLRHEVLEGNVGYLRVDSVPGQEVLSMMGEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGIPYIISYLHPGNTILHVDTIYNRPSNTTTEIWTLPQVLGERYGADKDVVVLTSSQTRGVAEDIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQTWEGSGVLPCVGTPAEQALEKALAIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus cereus Leucine--tRNA ligase (leuS), partial
MBS1035679 Inquire

Recombinant Bacillus cereus Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details
Olfr1026 Protein Vector (Mouse) (pPM-C-His)
PV207965 500 ng

Olfr1026 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
UBXD2 Antibody
GWB-MQ857B 100 µg

UBXD2 Antibody

Sign In for Pricing
View Details
MYH (MUTYH) (NM_001048171) Human Tagged Lenti ORF Clone
RC212561L3 10 µg

MYH (MUTYH) (NM_001048171) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Monkey Interleukin 12 p40 ELISA Kit
MBS752572-01 48 Well

Monkey Interleukin 12 p40 ELISA Kit

Sign In for Pricing
View Details
Monkey Interleukin 12 p40 ELISA Kit
MBS752572-02 96 Well

Monkey Interleukin 12 p40 ELISA Kit

Sign In for Pricing
View Details