Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPA Rabbit pAb (APR26479N)

Product Specifications

Background

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase) . This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LIPA Rabbit pAb (APR26479N) .

Synonyms

LIPA; CESD; LAL; lipase A

Gene ID

3988

UniProt

P38571

Cellular Locus

Lysosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/45kDa Observed MW: 40-45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3988

Uniprot URL

https://www.uniprot.org/uniprot/P38571

AA Sequence

DAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JNK1 (MAPK8) (C-term) Rabbit Polyclonal Antibody
AP14120PU-N 400 µL

JNK1 (MAPK8) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Multi Angle Spectrophotometer BMAS-1205
BMAS-1205 1 Unit

Multi Angle Spectrophotometer BMAS-1205

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), 0.2mg/mL
BNUB2551-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), 0.2mg/mL

Sign In for Pricing
View Details
Medium Water Purification System BDPS-403
BDPS-403 1 Unit

Medium Water Purification System BDPS-403

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800248 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
PQBP1 (NM_001032381) Human Over-expression Lysate
LC422317 20 µg

PQBP1 (NM_001032381) Human Over-expression Lysate

Sign In for Pricing
View Details