Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPA Rabbit pAb (APR26479N)

Product Specifications

Background

This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase) . This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LIPA Rabbit pAb (APR26479N) .

Synonyms

LIPA; CESD; LAL; lipase A

Gene ID

3988

UniProt

P38571

Cellular Locus

Lysosome

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/45kDa Observed MW: 40-45kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3988

Uniprot URL

https://www.uniprot.org/uniprot/P38571

AA Sequence

DAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometriotic tissue
CS709896 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/3121R), CF640R conjugate, 0.1mg/mL
BNC403121-100 1x 100 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF405S conjugate, 0.1mg/mL
BNC042368-100 1x 100 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aspartate Aminotransferase (GOT1) Human Gene Knockout Kit (CRISPR)
KN401757 1 Kit

Aspartate Aminotransferase (GOT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS632177 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
2,5-Furandicarboxylic Acid
TRC-F863750-25G 25 g

2,5-Furandicarboxylic Acid

Sign In for Pricing
View Details