Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESE1/ELF3 Rabbit pAb (APR26466N)

Product Specifications

Background

Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development (By similarity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality ESE1/ELF3 Rabbit pAb (APR26466N) .

Synonyms

ELF3; EPR-1; ERT; ESE-1; ESX

Gene ID

1999

UniProt

P78545

Cellular Locus

Cytoplasm, Nucleus

Applications

WB (Homo sapiens, Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa/41kDa Observed MW: 42kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1999

Uniprot URL

https://www.uniprot.org/uniprot/P78545

AA Sequence

MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)
MBS6003362-01 0.2 mL

RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)

Sign In for Pricing
View Details
RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)
MBS6003362-02 5x 0.2 mL

RNH2C, ID (RNASEH2C, AYP1, Ribonuclease H2 subunit C, Aicardi-Goutieres syndrome 3 protein, RNase H1 small subunit, Ribonuclease HI subunit C)

Sign In for Pricing
View Details
Gba Antibody (Biotin)
orb47370-01 50 µg

Gba Antibody (Biotin)

Sign In for Pricing
View Details
Gba Antibody (Biotin)
orb47370-02 100 µg

Gba Antibody (Biotin)

Sign In for Pricing
View Details
CNNM3 Protein Vector (Mouse) (pPM-C-His)
PV166709 500 ng

CNNM3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SLC9A3R2 Rabbit Polyclonal Antibody (PE)
orb491749 100 µL

SLC9A3R2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details