Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A2 Rabbit pAb (APR26464N)

Product Specifications

Background

The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC26A2 Rabbit pAb (APR26464N) .

Synonyms

SLC26A2; D5S1708; DTD; DTDST; EDM4; MST153; MSTP157

Gene ID

1836

UniProt

P50443

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 81kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1836

Uniprot URL

https://www.uniprot.org/uniprot/P50443

AA Sequence

FCVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIKPGIKIFRFVAPLYYINKECFKSALYKQTVNPILIKVAWKKAAKRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAMAFAEVSKNQKGVCVPNGLSLSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ZCCHC10 shRNA (UAS) - Lentiviral human ZCCHC10 shRNA (UAS, GFP) (100)
GTR15100017 1 Vial

Lentiviral human ZCCHC10 shRNA (UAS) - Lentiviral human ZCCHC10 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
GENLISA™ Rabbit Immunoglobulin A (IgA) ELISA
KLX0432 1x 96 Well

GENLISA™ Rabbit Immunoglobulin A (IgA) ELISA

Sign In for Pricing
View Details
CCT6B (NM_001193530) Human Tagged ORF Clone
RC231267 10 µg

CCT6B (NM_001193530) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF488A conjugate, 0.1mg/mL
BNC882670-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2670), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZDHHC14 Rabbit Polyclonal Antibody (AP)
orb954544 100 µL

ZDHHC14 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
PHKG2 Rabbit Polyclonal Antibody
TA366260 100 µL

PHKG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details