Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC26A2 Rabbit pAb (APR26464N)

Product Specifications

Background

The diastrophic dysplasia sulfate transporter is a transmembrane glycoprotein implicated in the pathogenesis of several human chondrodysplasias. It apparently is critical in cartilage for sulfation of proteoglycans and matrix organization.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLC26A2 Rabbit pAb (APR26464N) .

Synonyms

SLC26A2; D5S1708; DTD; DTDST; EDM4; MST153; MSTP157

Gene ID

1836

UniProt

P50443

Cellular Locus

Membrane, Multi-pass membrane protein

Dilution

IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 81kDa Observed MW: Refer to Figures

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1836

Uniprot URL

https://www.uniprot.org/uniprot/P50443

AA Sequence

FCVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIKPGIKIFRFVAPLYYINKECFKSALYKQTVNPILIKVAWKKAAKRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAMAFAEVSKNQKGVCVPNGLSLSSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTF Rabbit Polyclonal Antibody (Cy3)
orb2573827 100 µg

CNTF Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
JAK2 antibody
70R-49947 100 ul

JAK2 antibody

Sign In for Pricing
View Details
SaMag STD DNA Extraction kit For use with SaMag-12/24 instruments; extraction of STD DNA (C.trachomatis, N.gonorrhoeae, HPV...) from swabs, urine sediment, prostatic liquid..
SM007 48 Tests

SaMag STD DNA Extraction kit For use with SaMag-12/24 instruments; extraction of STD DNA (C.trachomatis, N.gonorrhoeae, HPV...) from swabs, urine sediment, prostatic liquid..

Sign In for Pricing
View Details
C14orf156 Recombinant Protein (Human)
RP003754 100 µg

C14orf156 Recombinant Protein (Human)

Sign In for Pricing
View Details
1700007B14Rik Recombinant Protein (Mouse)
RP110051 100 µg

1700007B14Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
AURION BSA-c™ (10%)
900.099 30 mL

AURION BSA-c™ (10%)

Sign In for Pricing
View Details