Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRAT Rabbit pAb (APR26460N)

Product Specifications

Background

This gene encodes carnitine acetyltransferase (CRAT), which is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CRAT Rabbit pAb (APR26460N) .

Synonyms

CRAT; CAT; CAT1

Gene ID

1384

UniProt

P43155

Cellular Locus

Endoplasmic reticulum, Matrix side, Mitochondrion, Mitochondrion inner membrane, Peripheral membrane protein, Peroxisome

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 61kDa/68kDa/70kDa Observed MW: 68KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1384

Uniprot URL

https://www.uniprot.org/uniprot/P43155

AA Sequence

YVIEYTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit
MBS7215848-01 48 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit

Sign In for Pricing
View Details
Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit
MBS7215848-02 96 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit

Sign In for Pricing
View Details
Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit
MBS7215848-03 5x 96 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit

Sign In for Pricing
View Details
Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit
MBS7215848-04 10x 96 Well

Bovine A disintegrin and metalloproteinase with thrombospondin motifs 18 (ADAMTS18) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein-H, Sf9
MBS142943-01 0.005 mg

Recombinant Human Apolipoprotein-H, Sf9

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein-H, Sf9
MBS142943-02 0.02 mg

Recombinant Human Apolipoprotein-H, Sf9

Sign In for Pricing
View Details