Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPS Rabbit pAb (APR26459N)

Product Specifications

Background

The protein encoded by this gene is a cofactor needed by pancreatic lipase for efficient dietary lipid hydrolysis. It binds to the C-terminal, non-catalytic domain of lipase, thereby stabilizing an active conformation and considerably increasing the overall hydrophobic binding site. The gene product allows lipase to anchor noncovalently to the surface of lipid micelles, counteracting the destabilizing influence of intestinal bile salts. This cofactor is only expressed in pancreatic acinar cells, suggesting regulation of expression by tissue-specific elements. Three transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CLPS Rabbit pAb (APR26459N) .

Synonyms

CLPS; colipase

Gene ID

1208

UniProt

P04118

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 11kDa Observed MW: 12kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1208

Uniprot URL

https://www.uniprot.org/uniprot/P04118

AA Sequence

APGPRGIIINLENGELCMNSAQCKSNCCQHSSALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Carboxylesterase 2/CES2 Affinity Purified PAb
AF5657 100 µg

Human Carboxylesterase 2/CES2 Affinity Purified PAb

Sign In for Pricing
View Details
NOL7 (NM_016167) Human Untagged Clone
SC114402 10 µg

NOL7 (NM_016167) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Monoclonal TDO2 Antibody (998604) [Allophycocyanin]
FAB9768A 0.1 mL

Mouse Monoclonal TDO2 Antibody (998604) [Allophycocyanin]

Sign In for Pricing
View Details
Mouse Hepcidin (HAMP) CLIA Kit
abx490447-01 96 Tests

Mouse Hepcidin (HAMP) CLIA Kit

Sign In for Pricing
View Details
Mouse Hepcidin (HAMP) CLIA Kit
abx490447-02 5x 96 Tests

Mouse Hepcidin (HAMP) CLIA Kit

Sign In for Pricing
View Details
Mouse Hepcidin (HAMP) CLIA Kit
abx490447-03 10x 96 Tests

Mouse Hepcidin (HAMP) CLIA Kit

Sign In for Pricing
View Details