Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibroblast activation protein-α (FAP) Rabbit pAb (APR26445N)

Product Specifications

Background

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Fibroblast activation protein-α (FAP) Rabbit pAb (APR26445N) .

Synonyms

FAP; DPPIV; FAPA; FAPalpha; SIMP

Gene ID

2191

UniProt

Q12884

Cellular Locus

Cell membrane, Cell projection, Cell surface, Cytoplasm, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane, ruffle membrane

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/87kDa Observed MW: 90KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2191

Uniprot URL

https://www.uniprot.org/uniprot/Q12884

AA Sequence

LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFL1, ID (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (MaxLight 550)
MBS6285377-01 0.1 mL

CFL1, ID (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (MaxLight 550)

Sign In for Pricing
View Details
CFL1, ID (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (MaxLight 550)
MBS6285377-02 5x 0.1 mL

CFL1, ID (CFL1, CFL, Cofilin-1, 18kD phosphoprotein, Cofilin, non-muscle isoform) (MaxLight 550)

Sign In for Pricing
View Details
Tissue cDNA, First Strand, Monkey (Rhesus) Adult Normal, Epididymis, BioGenomicsTM
T5595-0569 40 Tests

Tissue cDNA, First Strand, Monkey (Rhesus) Adult Normal, Epididymis, BioGenomicsTM

Sign In for Pricing
View Details
Monoclonal Cyclin B1 (G2- & M-phase Cyclin) Antibody - Without BSA and Azide, Clone: V92.1
AMM00437G 0.1mg

Monoclonal Cyclin B1 (G2- & M-phase Cyclin) Antibody - Without BSA and Azide, Clone: V92.1

Sign In for Pricing
View Details
Mouse Monoclonal Distemper Virus Antibody (8-1) [Alexa Fluor 405]
NB110-2603AF405 0.2 mL

Mouse Monoclonal Distemper Virus Antibody (8-1) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mep1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3422706 1.0 µg DNA

Mep1a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details