Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibroblast activation protein-α (FAP) Rabbit pAb (APR26445N)

Product Specifications

Background

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft tissue sarcomas. This protein is thought to be involved in the control of fibroblast growth or epithelial-mesenchymal interactions during development, tissue repair, and epithelial carcinogenesis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Fibroblast activation protein-α (FAP) Rabbit pAb (APR26445N) .

Synonyms

FAP; DPPIV; FAPA; FAPalpha; SIMP

Gene ID

2191

UniProt

Q12884

Cellular Locus

Cell membrane, Cell projection, Cell surface, Cytoplasm, Membrane, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein, invadopodium membrane, lamellipodium membrane, ruffle membrane

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 26kDa/87kDa Observed MW: 90KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2191

Uniprot URL

https://www.uniprot.org/uniprot/Q12884

AA Sequence

LRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPNWISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSKLWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPPFQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYGDEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sumo 1 Rabbit mAb
E60M1293 100 µL

Sumo 1 Rabbit mAb

Sign In for Pricing
View Details
Lentiviral mouse Sesn3 shRNA (UAS) - Lentiviral mouse Sesn3 shRNA (UAS) plasmid
GTR15306286 1 Vial

Lentiviral mouse Sesn3 shRNA (UAS) - Lentiviral mouse Sesn3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Multi-species (Cattle, Dog, Dolphin, Goat, Guinea Pig, Horse, Cat, Human, Mink, Monkey, Ferret, Pig, Bat) IGF-1 Polyclonal Antibody
PB1331-01 20 µg

Multi-species (Cattle, Dog, Dolphin, Goat, Guinea Pig, Horse, Cat, Human, Mink, Monkey, Ferret, Pig, Bat) IGF-1 Polyclonal Antibody

Sign In for Pricing
View Details
Multi-species (Cattle, Dog, Dolphin, Goat, Guinea Pig, Horse, Cat, Human, Mink, Monkey, Ferret, Pig, Bat) IGF-1 Polyclonal Antibody
PB1331-02 100 µg

Multi-species (Cattle, Dog, Dolphin, Goat, Guinea Pig, Horse, Cat, Human, Mink, Monkey, Ferret, Pig, Bat) IGF-1 Polyclonal Antibody

Sign In for Pricing
View Details
SHISA3 (NM_001080505) Human Over-expression Lysate
LS152573-20ug 20 µg

SHISA3 (NM_001080505) Human Over-expression Lysate

Sign In for Pricing
View Details
EDAR Antibody
OAAL00548-100UG 100 µg

EDAR Antibody

Sign In for Pricing
View Details