Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCGF1 Rabbit pAb (APR26439N)

Product Specifications

Background

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]) . See also PCGF2 (MIM 600346) .[supplied by OMIM, Aug 2008]

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PCGF1 Rabbit pAb (APR26439N) .

Synonyms

PCGF1; 2010002K04Rik; NSPC1; RNF3A-2; RNF68

Gene ID

84759

UniProt

Q9BSM1

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa/30kDa Observed MW: 35KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=84759

Uniprot URL

https://www.uniprot.org/uniprot/Q9BSM1

AA Sequence

QSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Membrane IgA, mIgA ELISA KIT
E0248Bo-01 48 Well

Bovine Membrane IgA, mIgA ELISA KIT

Sign In for Pricing
View Details
Bovine Membrane IgA, mIgA ELISA KIT
E0248Bo-02 96 Well

Bovine Membrane IgA, mIgA ELISA KIT

Sign In for Pricing
View Details
Bovine Membrane IgA, mIgA ELISA KIT
E0248Bo-03 5x 96 Tests

Bovine Membrane IgA, mIgA ELISA KIT

Sign In for Pricing
View Details
Bovine Membrane IgA, mIgA ELISA KIT
E0248Bo-04 10x 96 Tests

Bovine Membrane IgA, mIgA ELISA KIT

Sign In for Pricing
View Details
ARL11 Rabbit Polyclonal Antibody
orb581771 100 µL

ARL11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ViPrimePLUS Enterococcus faecium qPCR Test Kit
VECE004 1 Kit

ViPrimePLUS Enterococcus faecium qPCR Test Kit

Sign In for Pricing
View Details