Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIP Rabbit pAb (APR26355N)

Product Specifications

Background

This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GIP Rabbit pAb (APR26355N) .

Synonyms

GIP

Gene ID

2695

UniProt

P09681

Cellular Locus

Secreted

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 17KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2695

Uniprot URL

https://www.uniprot.org/uniprot/P09681

AA Sequence

EKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (PE)
C2275-86U 500 µL

CD25 (Tac antigen, p55, Interleukin 2 Receptor alpha, IL2Ra, T Cell Growth Factor Receptor) (PE)

Sign In for Pricing
View Details
Vom2r76 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6071908 1.0 µg DNA

Vom2r76 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human TSPAN30/CD63 (Tetraspanin 30) QuickTest ELISA Kit
QT-EH20038 96 Tests

Human TSPAN30/CD63 (Tetraspanin 30) QuickTest ELISA Kit

Sign In for Pricing
View Details
TENT5A Rabbit Polyclonal Antibody
TA338892 100 µL

TENT5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FLJ32790 Polyclonal Antibody
orb1419503 100 µL

FLJ32790 Polyclonal Antibody

Sign In for Pricing
View Details
Human LFA1a ELISA Kit
orb437414 96 Tests

Human LFA1a ELISA Kit

Sign In for Pricing
View Details