Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Osteocalcin (BGLAP) Rabbit pAb (APR26332N)

Product Specifications

Background

This gene encodes a highly abundant bone protein secreted by osteoblasts that regulates bone remodeling and energy metabolism. The encoded protein contains a Gla (gamma carboxyglutamate) domain, which functions in binding to calcium and hydroxyapatite, the mineral component of bone. Serum osteocalcin levels may be negatively correlated with metabolic syndrome. Read-through transcription exists between this gene and the neighboring upstream gene, PMF1 (polyamine-modulated factor 1), but the encoded protein only shows sequence identity with the upstream gene product.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Osteocalcin (BGLAP) Rabbit pAb (APR26332N) .

Synonyms

BGLAP; BGP; OC; OCN; osteocalcin

Gene ID

632

UniProt

P02818

Cellular Locus

Secreted

Applications

IHC (Mouse intervertebral disc, Mus musculus) WB (Mus musculus, Rattus norvegicus, Homo sapiens)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: 12KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=632

Uniprot URL

https://www.uniprot.org/uniprot/P02818

AA Sequence

MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MyoD Polyclonal Antibody
JOT-AP05724-01 50ul

MyoD Polyclonal Antibody

Sign In for Pricing
View Details
MyoD Polyclonal Antibody
JOT-AP05724-02 100ul

MyoD Polyclonal Antibody

Sign In for Pricing
View Details
Tbc1d17 ORF Vector (Rat) (pORF)
46233016 1.0 µg DNA

Tbc1d17 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
DiagSupport™ Fmoc-Phe-MHPA PEG-Polystyrene Resin, 90 µm, 0.2-0.25 mmol/g
SPS-RA23-280 1 g

DiagSupport™ Fmoc-Phe-MHPA PEG-Polystyrene Resin, 90 µm, 0.2-0.25 mmol/g

Sign In for Pricing
View Details
Gcm1 antibody - middle region
MBS3203340-01 0.1 mL

Gcm1 antibody - middle region

Sign In for Pricing
View Details
Gcm1 antibody - middle region
MBS3203340-02 5x 0.1 mL

Gcm1 antibody - middle region

Sign In for Pricing
View Details