Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CXCL11 Rabbit pAb (APR26328N)

Product Specifications

Background

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CXCL11 Rabbit pAb (APR26328N) .

Synonyms

CXCL11; H174; I-TAC; IP-9; IP9; SCYB11; SCYB9B; b-R1

Gene ID

6373

UniProt

O14625

Cellular Locus

Secreted

Dilution

IHC 1:100 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6373

Uniprot URL

https://www.uniprot.org/uniprot/O14625

AA Sequence

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Acyl-coenzyme A Thioesterase 8 AssayLite™ Antibody (PerCP Conjugate)
33392-05171 5x 30 µg

Human Acyl-coenzyme A Thioesterase 8 AssayLite™ Antibody (PerCP Conjugate)

Ask
View Details
GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyclase C-activating Peptide II, Uroguanylin)
MBS6012742-01 0.1 mg

GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyclase C-activating Peptide II, Uroguanylin)

Ask
View Details
GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyclase C-activating Peptide II, Uroguanylin)
MBS6012742-02 5x 0.1 mg

GUCA2B (Guanylate Cyclase Activator 2B, Guanylate Cyclase C-activating Peptide 2, Guanylate Cyclase C-activating Peptide II, Uroguanylin)

Ask
View Details
BCL2 like 14 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62428R-BF594-01 20 µL

BCL2 like 14 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
BCL2 like 14 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62428R-BF594-02 100 µL

BCL2 like 14 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Ask
View Details
IRAK4 (p-T345/S346) Rabbit Polyclonal Antibody
E28PP1713 100 µL

IRAK4 (p-T345/S346) Rabbit Polyclonal Antibody

Ask
View Details