Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSD95 Rabbit pAb (APR26326N)

Product Specifications

Background

This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PSD95 Rabbit pAb (APR26326N) .

Synonyms

DLG4; PSD95; SAP-90; SAP90

Gene ID

1742

UniProt

P78352

Cellular Locus

Cell junction, Cell membrane, Cell projection, Peripheral membrane protein, axon, postsynaptic cell membrane, postsynaptic density, synapse

Applications

WB (Mus musculus) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 80kDa/85kDa Observed MW: 95KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1742

Uniprot URL

https://www.uniprot.org/uniprot/P78352

AA Sequence

MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Integrin beta 4/CD104 Antibody (422325) [DyLight 405]
FAB4060E 0.1 mL

Mouse Monoclonal Integrin beta 4/CD104 Antibody (422325) [DyLight 405]

Sign In for Pricing
View Details
CREB-1 Rabbit Polyclonal Antibody (Cy5)
orb910176 100 µL

CREB-1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
NDP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
31600061 1.0 µg DNA

NDP Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TTTY13 ORF Vector (Human) (pORF)
48745011 1.0 µg DNA

TTTY13 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8G1]
TA812617AM 100 µL

IL28 Receptor alpha (IFNLR1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8G1]

Sign In for Pricing
View Details
NCOA4 Mouse Monoclonal Antibody
E38QA9393 100 µL

NCOA4 Mouse Monoclonal Antibody

Sign In for Pricing
View Details